PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_56103.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 356aa    MW: 40621.3 Da    PI: 7.1671
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_56103.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.96.6e-5671361129
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                   +ppGfrFhPtdeelv++yL+kkv++kk++l +vik+vd+yk+ePwdL++  k+   e+++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++
  MLOC_56103.1   7 VPPGFRFHPTDEELVDYYLRKKVASKKIDL-DVIKDVDLYKIEPWDLQEkcKIGMeEQNDWYFFSHKDKKYPTGTRTNRATSAGFWKATGRDKPIYT 102
                   69****************************.9***************952433333556************************************** PP

           NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                    ++ lvg++ktLvfykgrap+g+k+dW+mheyrle
  MLOC_56103.1 103 -NHCLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                   .999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.55E-625156IPR003441NAC domain
PROSITE profilePS5100559.9457156IPR003441NAC domain
PfamPF023651.6E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MDTFSHVPPG FRFHPTDEEL VDYYLRKKVA SKKIDLDVIK DVDLYKIEPW DLQEKCKIGM  60
EEQNDWYFFS HKDKKYPTGT RTNRATSAGF WKATGRDKPI YTNHCLVGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN GATPEEGWVV CRVFKKRVAT VRRMADMSSP CWFDDHGTGG  180
AFMPDLDSPR QLGYQHHHPQ NLAAYHSQPQ QQQHLYHCKP ELEYHHLLPQ EAFMQQLPHL  240
ESPKPTANIG HGSSSSSSLP LSTSNHPLAH DGASRFAAHQ PQMDHALYAG DSSATDWRLL  300
DKFVASQLFS HDGTNPKEQA THPNPAVQVF QAENRHEQAL DYASTSADGG SAHLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-51715717166NAC domain-containing protein 19
4dul_A3e-51715717166NAC domain-containing protein 19
1ut7_B3e-51715717166NO APICAL MERISTEM PROTEIN
1ut7_A3e-51715717166NO APICAL MERISTEM PROTEIN
1ut4_B3e-51715717166NO APICAL MERISTEM PROTEIN
1ut4_A3e-51715717166NO APICAL MERISTEM PROTEIN
3swp_D4e-51715720169NAC domain-containing protein 19
3swp_C4e-51715720169NAC domain-containing protein 19
3swp_B4e-51715720169NAC domain-containing protein 19
3swp_A4e-51715720169NAC domain-containing protein 19
3swm_D4e-51715720169NAC domain-containing protein 19
3swm_C4e-51715720169NAC domain-containing protein 19
3swm_B4e-51715720169NAC domain-containing protein 19
3swm_A4e-51715720169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266811.10.0uncharacterized protein LOC100832773
RefseqXP_010233638.10.0PREDICTED: uncharacterized protein LOC100832773 isoform X1
SwissprotQ9FWX21e-124NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM0X0R10.0M0X0R1_HORVD; Uncharacterized protein
STRINGMLOC_56103.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-109NAC 007